Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 5AK3 (OR5AK3P)

This Recombinant Human Putative olfactory receptor 5AK3 (OR5AK3P) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Putative olfactory receptor 5AK3

UniProt

Q8NH89

Expression Region

1-298

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRGNSTEVTEFHLLGFGVQHEFQHVLFIVLLLIYVTSLIGNIGMILLIKTDSRLQTPMY FFPQHLAFVDICYTSAITPKMLQSFTEENNLITFRGCVIQFLVYATFATSDCYLLAIMAM DCYVAICKPLRYPMIMSQTVYIQLVAGSYIIGSINASVHTGFTFSLSFCKSNKINHFFCD GLPILALSCSNIDINIILDVVFVGFDLMFTELVIIFSYIYIMVTILKMSSTAGRKKSFST CASHLTAVTIFYGTLSYMYLQPQSNNSQENMKVASIFYGTVIPMLNPLIYSLRNKEGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-5624-3p Primers
MPM01438 150 µL / 10 µM

mmu-miR-5624-3p Primers

Sign In for Pricing
View Details
Human ZNF189 (NM_001278231) AAV Particle
RC239085A1V 250 µL

Human ZNF189 (NM_001278231) AAV Particle

Sign In for Pricing
View Details
Rabbit Polyclonal KLC1 Antibody [Alexa Fluor 594]
NBP1-46839AF594 0.1 mL

Rabbit Polyclonal KLC1 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
EXTL3 Polyclonal Antibody
MBS2554285-01 0.06 mL

EXTL3 Polyclonal Antibody

Sign In for Pricing
View Details
EXTL3 Polyclonal Antibody
MBS2554285-02 0.12 mL

EXTL3 Polyclonal Antibody

Sign In for Pricing
View Details
EXTL3 Polyclonal Antibody
MBS2554285-03 0.2 mL

EXTL3 Polyclonal Antibody

Sign In for Pricing
View Details