Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-30 (srg-30)

This Recombinant Serpentine receptor class gamma-30 (srg-30) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-30, Protein srg-30

UniProt

O45150

Expression Region

1-299

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKCHPGFNTKLELLKYGIQFVYFIVGLGFHFAVIKVLHKKWSVYSKYPFLKLYYVDSIL SVLIILLDLVLIRVFNYIPPLCQWVLQEFPEPSQLISILFIEQYLQFVKSLIFCFMVVNR ANNVICVKSFGTIQSCIIPHVIVFCILCPLLGVWTAFLSDSRFVPFQGGFIHETMMEYHW ITVSQFSVIISSITIVTVCICSVISMLCISRTHAENKHTEQSLTASALAMSIFYVFALSM NIYCQKAHASSLEMLEFWKALTAFAFDIILVCPPVIMLCLNVRLRINVFSVDTRPTSPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-100 1x 100 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CHST13 Antibody
8C14924-AAT 50 µg

CHST13 Antibody

Sign In for Pricing
View Details
STIP1 Antibody
KC-1968-01 50 μL

STIP1 Antibody

Sign In for Pricing
View Details
STIP1 Antibody
KC-1968-02 100 µL

STIP1 Antibody

Sign In for Pricing
View Details
STIP1 Antibody
KC-1968-03 1 mL

STIP1 Antibody

Sign In for Pricing
View Details
4-Ethyl-pyridine-2-carboxylic Acid-d5 Hydrochloride
TRC-E925502-1MG 1 mg

4-Ethyl-pyridine-2-carboxylic Acid-d5 Hydrochloride

Sign In for Pricing
View Details