Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-30 (srg-30)

This Recombinant Serpentine receptor class gamma-30 (srg-30) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-30, Protein srg-30

UniProt

O45150

Expression Region

1-299

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKCHPGFNTKLELLKYGIQFVYFIVGLGFHFAVIKVLHKKWSVYSKYPFLKLYYVDSIL SVLIILLDLVLIRVFNYIPPLCQWVLQEFPEPSQLISILFIEQYLQFVKSLIFCFMVVNR ANNVICVKSFGTIQSCIIPHVIVFCILCPLLGVWTAFLSDSRFVPFQGGFIHETMMEYHW ITVSQFSVIISSITIVTVCICSVISMLCISRTHAENKHTEQSLTASALAMSIFYVFALSM NIYCQKAHASSLEMLEFWKALTAFAFDIILVCPPVIMLCLNVRLRINVFSVDTRPTSPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SuLT1A4 (NM_001017390) Human Recombinant Protein
TP309931M 100 µg

SuLT1A4 (NM_001017390) Human Recombinant Protein

Sign In for Pricing
View Details
Rat Tryptase (TPS) ELISA Kit
RDR-TPS-Ra-01 96 Tests

Rat Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details
Rat Tryptase (TPS) ELISA Kit
RDR-TPS-Ra-02 48 Tests

Rat Tryptase (TPS) ELISA Kit

Sign In for Pricing
View Details
CINP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]
TA812282AM 100 µL

CINP Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3E1]

Sign In for Pricing
View Details
Recombinant Estrogen Receptor alpha Antibody
RC-4965-01 50 μL

Recombinant Estrogen Receptor alpha Antibody

Sign In for Pricing
View Details
Recombinant Estrogen Receptor alpha Antibody
RC-4965-02 100 µL

Recombinant Estrogen Receptor alpha Antibody

Sign In for Pricing
View Details