Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-30 (srg-30)

This Recombinant Serpentine receptor class gamma-30 (srg-30) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-30, Protein srg-30

UniProt

O45150

Expression Region

1-299

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKCHPGFNTKLELLKYGIQFVYFIVGLGFHFAVIKVLHKKWSVYSKYPFLKLYYVDSIL SVLIILLDLVLIRVFNYIPPLCQWVLQEFPEPSQLISILFIEQYLQFVKSLIFCFMVVNR ANNVICVKSFGTIQSCIIPHVIVFCILCPLLGVWTAFLSDSRFVPFQGGFIHETMMEYHW ITVSQFSVIISSITIVTVCICSVISMLCISRTHAENKHTEQSLTASALAMSIFYVFALSM NIYCQKAHASSLEMLEFWKALTAFAFDIILVCPPVIMLCLNVRLRINVFSVDTRPTSPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS632958 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
SO Green™ 520WS Singlet Oxygen Sensor *Water-Soluble for Extracellular Applications*
16061-AAT 10x 100 µg

SO Green™ 520WS Singlet Oxygen Sensor *Water-Soluble for Extracellular Applications*

Sign In for Pricing
View Details
EHD3 (NM_014600) Human Over-expression Lysate
LC402352 20 µg

EHD3 (NM_014600) Human Over-expression Lysate

Sign In for Pricing
View Details
SB 203580 Hydrochloride
TRC-S155058-50MG 50 mg

SB 203580 Hydrochloride

Sign In for Pricing
View Details
Vacuum Oven BOVA-5904
BOVA-5904 1 Unit

Vacuum Oven BOVA-5904

Sign In for Pricing
View Details
p107 (RBL1) (NM_183404) Human Over-expression Lysate
LY403655 100 µg

p107 (RBL1) (NM_183404) Human Over-expression Lysate

Sign In for Pricing
View Details