Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

Q5H5R3

Expression Region

1-299

Origin

Xanthomonas oryzae pv. oryzae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKHDVERLPAACGLTCPQRLGQYWQLVRGDRPIGSLLLLWPTWWALWLAADGLPPLWTL FVFTAGVWLTRSAGCVINDYADRWLDPHVERTKSRPLATGAVSGREALWVFVVLMLVAFA LVFTLNWLTVLLSVPGVFLAASYPYLKRHTHLPQVYLGMAFGWGIPMAFAAVQGSVPVLG WLLYAANILWATAYDTWYAMVDRDDDIRMGSKSTAILFGRFDLVAQGILYALMFAVLALV DLRADLGAAYWAGLGVAALLVAYEFRIARHRERGPCFRAFLHNNWVGLAIFVGIAVAGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E6]
TA801710AM 100 µL

PI 3 Kinase Class 2A (PIK3C2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E6]

Sign In for Pricing
View Details
Mouse Syndecan 1 (SDC1) ELISA Kit
RDR-SDC1-Mu-01 96 Tests

Mouse Syndecan 1 (SDC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Syndecan 1 (SDC1) ELISA Kit
RDR-SDC1-Mu-02 48 Tests

Mouse Syndecan 1 (SDC1) ELISA Kit

Sign In for Pricing
View Details
PDE7B Polyclonal Antibody
E-AB-90352-01 60 µL

PDE7B Polyclonal Antibody

Sign In for Pricing
View Details
PDE7B Polyclonal Antibody
E-AB-90352-02 120 µL

PDE7B Polyclonal Antibody

Sign In for Pricing
View Details
PDE7B Polyclonal Antibody
E-AB-90352-03 200 µL

PDE7B Polyclonal Antibody

Sign In for Pricing
View Details