Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

Q5H5R3

Expression Region

1-299

Origin

Xanthomonas oryzae pv. oryzae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKHDVERLPAACGLTCPQRLGQYWQLVRGDRPIGSLLLLWPTWWALWLAADGLPPLWTL FVFTAGVWLTRSAGCVINDYADRWLDPHVERTKSRPLATGAVSGREALWVFVVLMLVAFA LVFTLNWLTVLLSVPGVFLAASYPYLKRHTHLPQVYLGMAFGWGIPMAFAAVQGSVPVLG WLLYAANILWATAYDTWYAMVDRDDDIRMGSKSTAILFGRFDLVAQGILYALMFAVLALV DLRADLGAAYWAGLGVAALLVAYEFRIARHRERGPCFRAFLHNNWVGLAIFVGIAVAGR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Water Chiller BCHI-412
BCHI-412 Each

Water Chiller BCHI-412

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), CF647 conjugate, 0.1mg/mL
BNC472306-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (rMMP3/1730), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sodium Bisulfite (mixture of NaHSO3 and Na2S2O5)
TRC-S614400-25G 25 g

Sodium Bisulfite (mixture of NaHSO3 and Na2S2O5)

Sign In for Pricing
View Details
NANOS3 Human Gene Knockout Kit (CRISPR)
KN421867 1 Kit

NANOS3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
alpha smooth muscle Actin (ACTA2) Mouse Monoclonal Antibody [Clone ID: 4A4]
AM06647SU-N 100 µL

alpha smooth muscle Actin (ACTA2) Mouse Monoclonal Antibody [Clone ID: 4A4]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS702071 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details