Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0440 (MJ0440)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0440 (MJ0440) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0440

UniProt

Q57882

Expression Region

1-299

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYYKLVLSHYSKTSTLINITLIKHLINILRERMIQEIKNFIYKYYIEPAEKGTGYNIVQE ITYGIILALALYLFYKALRKLNINIDEKFAIPGIVFTVLIALMRALVDCGYIERSFLTIT PGIVFLIGGFFILTILTTGLVFKEKYYKASAVIGLILLLYFLFVFLQHITHLEAILYVGI LVGIFYYLVKFLDKTLKLNIIQSKIDDYVVIGQLIDASATTIGIGVYGYWEQHPIPRFLM ETFGVYAFIPFKLLIILLALYILNKEVEDENIKNIIKLCIMALGLAPGLRDLFRTVMGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LKB1 (STK11) Human Gene Knockout Kit (CRISPR)
KN202885 1 Kit

LKB1 (STK11) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF488A conjugate, 0.1mg/mL
BNC882284-100 1x 100 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rL1C1), 0.2mg/mL
BNUB2222-100 1x 100 µL

Human Kappa Light Chain (B-Cell Marker) (rL1C1), 0.2mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712113 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
SPIRE2 (NM_032451) Human Over-expression Lysate
LY403163 100 µg

SPIRE2 (NM_032451) Human Over-expression Lysate

Sign In for Pricing
View Details
N-Nitrosoephedrine
TRC-N137360-50MG 50 mg

N-Nitrosoephedrine

Sign In for Pricing
View Details