Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0440 (MJ0440)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0440 (MJ0440) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0440

UniProt

Q57882

Expression Region

1-299

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYYKLVLSHYSKTSTLINITLIKHLINILRERMIQEIKNFIYKYYIEPAEKGTGYNIVQE ITYGIILALALYLFYKALRKLNINIDEKFAIPGIVFTVLIALMRALVDCGYIERSFLTIT PGIVFLIGGFFILTILTTGLVFKEKYYKASAVIGLILLLYFLFVFLQHITHLEAILYVGI LVGIFYYLVKFLDKTLKLNIIQSKIDDYVVIGQLIDASATTIGIGVYGYWEQHPIPRFLM ETFGVYAFIPFKLLIILLALYILNKEVEDENIKNIIKLCIMALGLAPGLRDLFRTVMGV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIF (C-term) Rabbit Polyclonal Antibody
AP23265PU-N 100 µg

MIF (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SKF-525A Hydrochloride
TRC-S550000-250MG 250 mg

SKF-525A Hydrochloride

Sign In for Pricing
View Details
Sucrose Heptasulfate Potassium Salt (>95% purity)
TRC-S698255-50MG 50 mg

Sucrose Heptasulfate Potassium Salt (>95% purity)

Sign In for Pricing
View Details
GNGT2 Polyclonal Antibody
E-AB-90721-01 60 µL

GNGT2 Polyclonal Antibody

Sign In for Pricing
View Details
GNGT2 Polyclonal Antibody
E-AB-90721-02 120 µL

GNGT2 Polyclonal Antibody

Sign In for Pricing
View Details
GNGT2 Polyclonal Antibody
E-AB-90721-03 200 µL

GNGT2 Polyclonal Antibody

Sign In for Pricing
View Details