Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Papio hamadryas Taste receptor type 2 member 5 (TAS2R5)

This Recombinant Papio hamadryas Taste receptor type 2 member 5 (TAS2R5) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 5, T2R5

UniProt

Q646E6

Expression Region

1-299

Origin

Papio hamadryas (Hamadryas baboon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSAGLGLLMLVAVIEFLIGLIGNGILVVWSLREWIRKFSWSSYNLIILGLAGCRFLLQW LIILDLSLFPLFQSSSWLRYLNVFWVLVSQASLWFATFLSVFYCKKITTFDRPAYLWLKQ RAYNLSLWCLLGYFIISLLLTVQVGLTVHHPPQGNSSIRYPFEHWQYLYVFQLNSGSYLP LMVFLVSSGMLIISLYTHHKKMKVHSAGRRDARAKAHITALKSLGCFLLLHLVYIVASPF SITSKTYPPDLTSVFIWETLMAAYPSLHSLMLIMGIPRVKQTCQKILWKTVCARRCWGP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL
BNC470669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 6 (LHK6), CF647 conjugate, 0.1mg/mL
BNC470675-500 1x 500 µL

Cytokeratin 6 (LHK6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2990R), CF568 conjugate, 0.1mg/mL
BNC682990-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2990R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF640R conjugate, 0.1mg/mL
BNC402074-500 1x 500 µL

Prostate Specific Acid Phosphatase (PSAP) (rACPP/1338), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details