Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan paniscus Taste receptor type 2 member 19 (TAS2R19)

This Recombinant Pan paniscus Taste receptor type 2 member 19 (TAS2R19) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 19, Taste receptor type 2 member 48, T2R48

UniProt

Q5Y4Z5

Expression Region

1-299

Origin

Pan paniscus (Pygmy chimpanzee) (Bonobo)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMCFLLIILSILVVFAFVLGNFSNGFIALVNVIDWVNTRKISSADQILTALVVSRIGLLW VMLFLWYATVFNSALYGLEVRIVASNAWAVMNHFSIWLAASLSIFCLLKIANFSNLIFLH LKKRIKSVVLVILLGPLVFLICNLAVITMDERVWTKEYEGNVTWKIKLRNAIQLSSLTVT TLANLIPFTLSLICFLLLICSLCKHLKKMRLHSKGSQDPSTKVHIKALQTVTSFLMLFAI YFLCIITSTWNLRTQQSKLVLLLCQTVAIMYPSFHSFILIMGSRKLKQTFLSVLWQMTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL
BNC880009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (BX006 + 2H12), CF594 conjugate, 0.1mg/mL
BNC940752-100 1x 100 µL

Bcl-x (BX006 + 2H12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF640R conjugate, 0.1mg/mL
BNC402651-500 1x 500 µL

Interleukin 10 (IL10) (Immunoregulation Marker) (IL10/2651R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details