Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Papio hamadryas Taste receptor type 2 member 4 (TAS2R4)

This Recombinant Papio hamadryas Taste receptor type 2 member 4 (TAS2R4) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 4, T2R4

UniProt

Q646F1

Expression Region

1-299

Origin

Papio hamadryas (Hamadryas baboon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLWLFYSSAIIASVILDFVGIIMSLFITVVNYKTWVKSHRISSSERILFSLGITRFFMLA LFLVNTIYFVSSNKERSVYLSAFFVLCFMFLDSSSLWFVTLLNSLYCVKITNFQHSVFLL LKRNISPKIPRLLPACVLISAFTTCLYITLSQASPFPELVTKRNNTSFNISEGILSLVVS FVLSSSLQFIINVTSASLLIYSLRRHIRKMQKNATGFWNPQTEAHVGAMKLMIYFLILYI PYSVATLVQYLPFYAGMDMGTKSICLIFATLYSPGHSVLIIITHPKLKTTAKKILCFKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-100 1x 100 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL
BNC680806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF568 conjugate, 0.1mg/mL
BNC680175-100 1x 100 µL

CD46 (122.2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL
BNC400050-100 1x 100 µL

IgA Secretory Component (SC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF740 conjugate, 0.1mg/mL
BNC740039-100 1x 100 µL

CD34 (ICO-115), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD147 (8D6), CF640R conjugate, 0.1mg/mL
BNC400424-100 1x 100 µL

CD147 (8D6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details