Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 4A4 (OR4A4P)

This Recombinant Human Putative olfactory receptor 4A4 (OR4A4P) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Putative olfactory receptor 4A4, Olfactory receptor OR11-107

UniProt

Q8NGN8

Expression Region

1-299

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPRKNVTDFVLLGFTQNPKEQKVLFVMFLLFYILTMVGNLLIVVTVTVSETLGSPMSFF LAGLTFIDIIYSSSISPRLISDLFFGNNSISFQSFMAQLFIEHLFGGSEVFLLLVMAYDR YVAICKPLHYLVIMRQWVCVLLLVVSWVGGFLQSVFQLSIIYGLPFCGPNVIDHFFCDMY PLLKLACTDTHVIGLLVVANGGLSCTIAFLLLLISYGVILHSLKKLSQKGRQKAHSTCSS HITVVVFFFVPCIFMCARPARTFSIDKSVSVFYTVITPMLNPLIYTLRNSEMTSAMKKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHAG Antibody - middle region : Biotin (ARP41705_T100-Biotin)
ARP41705_T100-Biotin 100 µL

RHAG Antibody - middle region : Biotin (ARP41705_T100-Biotin)

Sign In for Pricing
View Details
ZKSCAN17 (Zinc Finger Protein 496, Zinc Finger Protein with KRAB and SCAN Domains 17)
496100 100 µL

ZKSCAN17 (Zinc Finger Protein 496, Zinc Finger Protein with KRAB and SCAN Domains 17)

Sign In for Pricing
View Details
GPCR HM74 Polyclonal Antibody, HRP Conjugated
bs-15367R-HRP 100 µL

GPCR HM74 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Chicken Alpha-Fetoprotein L3 ELISA Kit
MBS019367 Inquire

Chicken Alpha-Fetoprotein L3 ELISA Kit

Sign In for Pricing
View Details
Benzyl 2,3,4-tri-O-benzyl-β-D-glucopyranoside
GC2972-250mg 250 mg

Benzyl 2,3,4-tri-O-benzyl-β-D-glucopyranoside

Sign In for Pricing
View Details
LPS (Lipopolysaccharides) ELISA Kit
EU3126 96 Tests

LPS (Lipopolysaccharides) ELISA Kit

Sign In for Pricing
View Details