Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 4A4 (OR4A4P)

This Recombinant Human Putative olfactory receptor 4A4 (OR4A4P) spans the amino acid sequence from region 1-299.

Product Specifications

Product Name Alternative

Putative olfactory receptor 4A4, Olfactory receptor OR11-107

UniProt

Q8NGN8

Expression Region

1-299

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPRKNVTDFVLLGFTQNPKEQKVLFVMFLLFYILTMVGNLLIVVTVTVSETLGSPMSFF LAGLTFIDIIYSSSISPRLISDLFFGNNSISFQSFMAQLFIEHLFGGSEVFLLLVMAYDR YVAICKPLHYLVIMRQWVCVLLLVVSWVGGFLQSVFQLSIIYGLPFCGPNVIDHFFCDMY PLLKLACTDTHVIGLLVVANGGLSCTIAFLLLLISYGVILHSLKKLSQKGRQKAHSTCSS HITVVVFFFVPCIFMCARPARTFSIDKSVSVFYTVITPMLNPLIYTLRNSEMTSAMKKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAP1 Antibody
A15985-100UG 100 µg

YAP1 Antibody

Sign In for Pricing
View Details
Adracalin (AAAS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7H7]
TA808617BM 100 µL

Adracalin (AAAS) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7H7]

Sign In for Pricing
View Details
Rabbit Apelin-13 (AP-13) ELISA Kit
MBS2612021-01 48 Well

Rabbit Apelin-13 (AP-13) ELISA Kit

Sign In for Pricing
View Details
Rabbit Apelin-13 (AP-13) ELISA Kit
MBS2612021-02 96 Well

Rabbit Apelin-13 (AP-13) ELISA Kit

Sign In for Pricing
View Details
Rabbit Apelin-13 (AP-13) ELISA Kit
MBS2612021-03 5x 96 Well

Rabbit Apelin-13 (AP-13) ELISA Kit

Sign In for Pricing
View Details
Rabbit Apelin-13 (AP-13) ELISA Kit
MBS2612021-04 10x 96 Well

Rabbit Apelin-13 (AP-13) ELISA Kit

Sign In for Pricing
View Details