Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Post-GPI attachment to proteins factor 3 (PGAP3)

This Recombinant Human Post-GPI attachment to proteins factor 3 (PGAP3) spans the amino acid sequence from region 21-320.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 3, COS16 homolog, hCOS16, Gene coamplified with ERBB2 protein, PER1-like domain-containing protein 1

UniProt

Q96FM1

Expression Region

21-320

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLY LQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLVMLCRYRTFVPASSPMYHTCV AFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAVVSAFR ALLLLMLTVHVSYLSLIRFDYGYNLVANVAIGLVNVVWWLAWCLWNQRRLPHVRKCVVVV LLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLKESEDKFKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stathmin 1 (STMN1) (NM_203401) Human Recombinant Protein
TP305073 20 µg

Stathmin 1 (STMN1) (NM_203401) Human Recombinant Protein

Sign In for Pricing
View Details
Gibberellin A1
TRC-G377495-5MG 5 mg

Gibberellin A1

Sign In for Pricing
View Details
CARD11 Human Gene Knockout Kit (CRISPR)
KN222740BN 1 Kit

CARD11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NQO1 (NM_001025434) Human Over-expression Lysate
LY422443 100 µg

NQO1 (NM_001025434) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC25A31 Antibody
8C14335-AAT 50 µg

SLC25A31 Antibody

Sign In for Pricing
View Details
RAGE Antibody (HRP)
KH-2796-01 50 μL

RAGE Antibody (HRP)

Sign In for Pricing
View Details