Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Post-GPI attachment to proteins factor 3 (PGAP3)

This Recombinant Human Post-GPI attachment to proteins factor 3 (PGAP3) spans the amino acid sequence from region 21-320.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 3, COS16 homolog, hCOS16, Gene coamplified with ERBB2 protein, PER1-like domain-containing protein 1

UniProt

Q96FM1

Expression Region

21-320

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLY LQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLVMLCRYRTFVPASSPMYHTCV AFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAVVSAFR ALLLLMLTVHVSYLSLIRFDYGYNLVANVAIGLVNVVWWLAWCLWNQRRLPHVRKCVVVV LLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLKESEDKFKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nance Horan Syndrome Protein (NHS) Human Gene Knockout Kit (CRISPR)
KN421208 1 Kit

Nance Horan Syndrome Protein (NHS) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APC Anti-Human CD138/Syndecan-1 Antibody[DL-101]
E-AB-F1154E-01 20 Tests

APC Anti-Human CD138/Syndecan-1 Antibody[DL-101]

Sign In for Pricing
View Details
APC Anti-Human CD138/Syndecan-1 Antibody[DL-101]
E-AB-F1154E-02 100 Tests

APC Anti-Human CD138/Syndecan-1 Antibody[DL-101]

Sign In for Pricing
View Details
APC Anti-Human CD138/Syndecan-1 Antibody[DL-101]
E-AB-F1154E-03 2x 100 Tests

APC Anti-Human CD138/Syndecan-1 Antibody[DL-101]

Sign In for Pricing
View Details
KLF2 Mouse Monoclonal Antibody [Clone ID: OTI2C8]
CF807008 100 µg

KLF2 Mouse Monoclonal Antibody [Clone ID: OTI2C8]

Sign In for Pricing
View Details
Human FAM120C activation kit by CRISPRa
GA110400 1 Kit

Human FAM120C activation kit by CRISPRa

Sign In for Pricing
View Details