Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Post-GPI attachment to proteins factor 3 (PGAP3)

This Recombinant Human Post-GPI attachment to proteins factor 3 (PGAP3) spans the amino acid sequence from region 21-320.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 3, COS16 homolog, hCOS16, Gene coamplified with ERBB2 protein, PER1-like domain-containing protein 1

UniProt

Q96FM1

Expression Region

21-320

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SQGDREPVYRDCVLQCEEQNCSGGALNHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLY LQEGHKVPQFHGKWPFSRFLFFQEPASAVASFLNGLASLVMLCRYRTFVPASSPMYHTCV AFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAVVSAFR ALLLLMLTVHVSYLSLIRFDYGYNLVANVAIGLVNVVWWLAWCLWNQRRLPHVRKCVVVV LLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLKESEDKFKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JWH 250
TRC-J211500-1MG 1 mg

JWH 250

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS801636 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF405S conjugate, 0.1mg/mL
BNC043048-500 1x 500 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
1-Amino-2-naphthol-4-sulfonic Acid
TRC-A619008-500MG 500 mg

1-Amino-2-naphthol-4-sulfonic Acid

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF568 conjugate, 0.1mg/mL
BNC681997-100 1x 100 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Acan activation kit by CRISPRa
GA200117 1 Kit

Mouse Acan activation kit by CRISPRa

Sign In for Pricing
View Details