Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus clausii Heme A synthase (ctaA)

This Recombinant Bacillus clausii Heme A synthase (ctaA) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q5WFD1

Expression Region

1-301

Origin

Bacillus clausii (strain KSM-K16)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKGLKRLGVITSLGVLLVLIQGALVTNTGSGEGCGQTWPLCFGQVIPLDPPPETVIEFS HRLVAGIVGMLVILMAIWSWRRLKHMPETRFLAVISVFMIIFQGLLGAGAVVFGQSDLIM ALHFGFSALSFASVVLLTRLAFEDSNPQKQYAPIVSKAYKGYVIFVAIYSYVAIYTGAYV KHTNATLACSGFPLCNGQWVPDVFTEAIGVQLLHRSAAILLSLLLLVLFIWTVKTFRASR VLVVCASLAMLLVIGQAASGVAVVLTYNATLTLGIFHALLISLLFTLLCYMVMLVTRHKA K

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mechanical Ultrasonic desktop cleaner BULC-410
BULC-410 1 Unit

Mechanical Ultrasonic desktop cleaner BULC-410

Sign In for Pricing
View Details
USP28 Mouse Monoclonal Antibody [A1F8]
EM1901-47 100 µL

USP28 Mouse Monoclonal Antibody [A1F8]

Sign In for Pricing
View Details
UACA / Nucling (AE-5), 1mg/mL
BNUM0956-50 1x 50 µL

UACA / Nucling (AE-5), 1mg/mL

Sign In for Pricing
View Details
Nlrp6 Mouse Gene Knockout Kit (CRISPR)
KN311056LP 1 Kit

Nlrp6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ELOF1 activation kit by CRISPRa
GA113529 1 Kit

Human ELOF1 activation kit by CRISPRa

Sign In for Pricing
View Details
tert-Butyl Diazoacetate, 85%
TRC-B691035-5G 5 g

tert-Butyl Diazoacetate, 85%

Sign In for Pricing
View Details