Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Growth hormone-inducible transmembrane protein (Ghitm)

This Recombinant Rat Growth hormone-inducible transmembrane protein (Ghitm) spans the amino acid sequence from region 46-346.

Product Specifications

Product Name Alternative

Growth hormone-inducible transmembrane protein, Mitochondrial morphology and cristae structure 1, MICS1

UniProt

Q5XIA8

Expression Region

46-346

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YATKTRIRTHRGKTGQELKEAALEPSLEKVFKIDQMGKWFVAGGAAVGLGALCYYGLGMS NEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSALALARSPALMNFMMTGSWMTIG ATFAAMIGAGMLVQSISYEQSPGPKHLAWMLHSGVMGAVVAPLTILGGPLLLRAAWYTAG IVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFASSLGSMFLPPTSVAGATLYSVAMYGGL VLFSMFLLYDTQKVVKRAEITPAYGAQKYDPINSMLTIYMDTLNIFMRVATMLATGSNRK K

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-500 1x 500 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-100 1x 100 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL
BNC940050-500 1x 500 µL

IgA Secretory Component (SC05), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF568 conjugate, 0.1mg/mL
BNC680778-500 1x 500 µL

Cytokeratin 17 (KRT17/778), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (Ki-1/779), CF647 conjugate, 0.1mg/mL
BNC470779-500 1x 500 µL

CD30 (Ki-1/779), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details