Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo pygmaeus Vomeronasal type-1 receptor 4 (VN1R4)

This Recombinant Pongo pygmaeus Vomeronasal type-1 receptor 4 (VN1R4) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Vomeronasal type-1 receptor 4, V1r-like receptor 4

UniProt

Q7YRP2

Expression Region

1-301

Origin

Pongo pygmaeus (Bornean orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASRYVAVGMMLSQTVVGVLGSFSLLLHYLSLHYIGCRLRSADLIVKHLIAASFLTLLCK GVPQTMAAFRVRYFLNAIGCKLVFYLHRVGRGVSTGTTCLLSVFQVITVSSRKSRWAKLK EKAPKHVGFSVLLCWILCMLVNIIFPIYVTGKRNHTNITVNKDLGDCCGRGNNKIAQTLR AMLLSFPDVLCLGFMLWASSSMVCILHRHKQRVQHIHRSNLSPRASPENRATQSILIPVS TFVSSYTLSCLLQVCMALLDNPNSLLVNTSALMSACFPTLSPFVLMSCDPSVYRLCFAWK R

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL
BNC680043-500 1x 500 µL

P21 / WAF1 (WA-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL
BNC470226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-500 1x 500 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL
BNC040276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-500 1x 500 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-500 1x 500 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details