Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member A6 (Mrgpra6)

This Recombinant Mouse Mas-related G-protein coupled receptor member A6 (Mrgpra6) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member A6

UniProt

Q91ZC6

Expression Region

1-301

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHRSISIRILITNLMIVILGLVGLTGNAIVFWLLLFRLRRNAFSIYILNLALADFLFLLC HIIASTEHILTFSSPNSIFINCLYTFRVLLYIAGLSMLSAISIERCLSVMCPIWYRCHSP EHTSTVMCAMIWVLSLLLCILYRYFCGFLDTKYEDDYGCLAMNFLTTAYLMFLFVVLCVS SLALLARLFCGAGRMKLTRLYVTITLTLLVFLLCGLPCGFYWFLLSKIKNVFTVFEFSLY LASVVLTAINSCANPIIYFFVGSFRHRLKHQTLKMVLQSALQDTPETPENMVEMSRNKAE L

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-500 1x 500 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF594 conjugate, 0.1mg/mL
BNC941969-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (NR-4), CF568 conjugate, 0.1mg/mL
BNC680303-500 1x 500 µL

Neurofilament (NF-L) (NR-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/775), CF568 conjugate, 0.1mg/mL
BNC680775-100 1x 100 µL

Pgp9.5 (UCHL-1) (UCHL1/775), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/413), CF568 conjugate, 0.1mg/mL
BNC680413-100 1x 100 µL

Chromogranin A (CHGA/413), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF594 conjugate, 0.1mg/mL
BNC942418-500 1x 500 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details