Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cambarus ludovicianus Rhodopsin (RHO)

This Recombinant Cambarus ludovicianus Rhodopsin (RHO) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O16017

Expression Region

1-301

Origin

Cambarus ludovicianus (Painted devil crayfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LHMIHLHWYQYPPMNPMMYPLLLVFMLITGILCLAGNFVTIWVFMNTKSLRTPANLLVVN LAMSDFLMMFTMFPPMMITCYYHTWTLGATFCEVYAFLGNLCGCASIWTMVFITFDRYNV IVKGVAGEPLSTKKASLWILTVWVLSFTWCVAPFFGWNRYVPEGNLTGCGTDYLSEDILS RSYLYIYSTWVYFLPLAITIYCYVFIIKAVAAHEKGMRDQAKKMGIKSLRNEEAQKTSAE CRLAKIAMTTVALWFIAWTPYLLINWVGMFARSYLSPVYTIWGYVFAKANAVYNPIVYAI S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF640R conjugate, 0.1mg/mL
BNC400871-100 1x 100 µL

CD71 (66IG10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL
BNC880034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL
BNC940177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (DCS-72.F6 + KIP1/769 (SX53G8) ), CF647 conjugate, 0.1mg/mL
BNC471237-100 1x 100 µL

P27 / KIP1 (DCS-72.F6 + KIP1/769 (SX53G8) ), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details