Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Orconectes virilis Rhodopsin (RHO)

This Recombinant Orconectes virilis Rhodopsin (RHO) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O16019

Expression Region

1-301

Origin

Orconectes virilis (Virile crayfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LHMIHLHWYQYPPMNPMMYPLLLIFMLFTGILCLAGNFVTIWVFMNTKSLRTPANLLVVN LAMSDFLMMFTMFPPMMVTCYYHTWTLGPTFCQVYAFLGNLCGCASIWTMVFITFDRYNV IVKGVAGEPLSNKKAAMWILSVWVLSTAWCMAPFFGWNSYVPEGNLTGCGTDYLSEDILS RSYLYIYSTWVYFLPLTITIYCYVFIIKAVAAHEKGMRDQAKKMGIKSLRNEEAQKTSAE CRLAKIAMTTVALWFIAWTPYLLINWVGMFARSYLSPVYTIWGYVFAKANAVYNPIVYAI S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Homer (D-3) Alexa Fluor® 488
sc-17842 AF488 200 µg/mL

Homer (D-3) Alexa Fluor® 488

Sign In for Pricing
View Details
HTR2B (5-hydroxytryptamine (Serotonin) Receptor 2B, 5-HT (2B), 5-HT2B) (Biotin)
247330-Biotin 100 µL

HTR2B (5-hydroxytryptamine (Serotonin) Receptor 2B, 5-HT (2B), 5-HT2B) (Biotin)

Sign In for Pricing
View Details
NR1H2 Antibody - N-terminal region : FITC (ARP38906_T100-FITC)
ARP38906_T100-FITC 100 µL

NR1H2 Antibody - N-terminal region : FITC (ARP38906_T100-FITC)

Sign In for Pricing
View Details
MIRacle™ mmu-miR-7047-3p miRNA Agomir/Antagomir
AM3218 2 OD, 4 OD, 50 OD

MIRacle™ mmu-miR-7047-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
ACTBL1 Polyclonal Antibody, RBITC Conjugated
bs-8594R-RBITC 100 µL

ACTBL1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Recombinant Xanthomonas campestris pv. campestris 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)
MBS1405467-01 0.02 mg (E-Coli)

Recombinant Xanthomonas campestris pv. campestris 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA)

Sign In for Pricing
View Details