Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Orconectes virilis Rhodopsin (RHO)

This Recombinant Orconectes virilis Rhodopsin (RHO) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O16019

Expression Region

1-301

Origin

Orconectes virilis (Virile crayfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LHMIHLHWYQYPPMNPMMYPLLLIFMLFTGILCLAGNFVTIWVFMNTKSLRTPANLLVVN LAMSDFLMMFTMFPPMMVTCYYHTWTLGPTFCQVYAFLGNLCGCASIWTMVFITFDRYNV IVKGVAGEPLSNKKAAMWILSVWVLSTAWCMAPFFGWNSYVPEGNLTGCGTDYLSEDILS RSYLYIYSTWVYFLPLTITIYCYVFIIKAVAAHEKGMRDQAKKMGIKSLRNEEAQKTSAE CRLAKIAMTTVALWFIAWTPYLLINWVGMFARSYLSPVYTIWGYVFAKANAVYNPIVYAI S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Glutathione S Transferase Mu 1 (GSTm1) ELISA Kit
RD-GSTm1-Hu-96Tests 96 Tests

Human Glutathione S Transferase Mu 1 (GSTm1) ELISA Kit

Sign In for Pricing
View Details
Abcf2 (NM_001109666) Rat Tagged Lenti ORF Clone
RR206179L4 10 µg

Abcf2 (NM_001109666) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TACC1 shRNA (h) Lentiviral Particles
sc-37499-V 200 µL

TACC1 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
CCDC144NL, CT (CCDC144NL, Putative coiled-coil domain-containing protein 144 N-terminal-like) (FITC)
MBS6281555-01 0.2 mL

CCDC144NL, CT (CCDC144NL, Putative coiled-coil domain-containing protein 144 N-terminal-like) (FITC)

Sign In for Pricing
View Details
CCDC144NL, CT (CCDC144NL, Putative coiled-coil domain-containing protein 144 N-terminal-like) (FITC)
MBS6281555-02 5x 0.2 mL

CCDC144NL, CT (CCDC144NL, Putative coiled-coil domain-containing protein 144 N-terminal-like) (FITC)

Sign In for Pricing
View Details
CDC25C Antibody
orb571458-01 50 µg

CDC25C Antibody

Sign In for Pricing
View Details