Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Orconectes virilis Rhodopsin (RHO)

This Recombinant Orconectes virilis Rhodopsin (RHO) spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Rhodopsin

UniProt

O16019

Expression Region

1-301

Origin

Orconectes virilis (Virile crayfish)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

LHMIHLHWYQYPPMNPMMYPLLLIFMLFTGILCLAGNFVTIWVFMNTKSLRTPANLLVVN LAMSDFLMMFTMFPPMMVTCYYHTWTLGPTFCQVYAFLGNLCGCASIWTMVFITFDRYNV IVKGVAGEPLSNKKAAMWILSVWVLSTAWCMAPFFGWNSYVPEGNLTGCGTDYLSEDILS RSYLYIYSTWVYFLPLTITIYCYVFIIKAVAAHEKGMRDQAKKMGIKSLRNEEAQKTSAE CRLAKIAMTTVALWFIAWTPYLLINWVGMFARSYLSPVYTIWGYVFAKANAVYNPIVYAI S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TIM10/TIMM10 Rabbit Polyclonal Antibody (Fluoro488)
orb3095207 100 µg

TIM10/TIMM10 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
HECW2, ID (HECW2, KIAA1301, NEDL2, E3 ubiquitin-protein ligase HECW2, HECT, C2 and WW domain-containing protein 2, NEDD4-like E3 ubiquitin-protein ligase 2) (AP) discontinued
036498-AP 200 µL

HECW2, ID (HECW2, KIAA1301, NEDL2, E3 ubiquitin-protein ligase HECW2, HECT, C2 and WW domain-containing protein 2, NEDD4-like E3 ubiquitin-protein ligase 2) (AP) discontinued

Sign In for Pricing
View Details
2-O-tert-Butoxycarbonyl-benzoic Acid Ethyl Ester
B690085 100 mg

2-O-tert-Butoxycarbonyl-benzoic Acid Ethyl Ester

Sign In for Pricing
View Details
NT5C1B (NM_033253) Human Tagged ORF Clone Lentiviral Particle
RC224105L3V 200 µL

NT5C1B (NM_033253) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RNF4 CRISPR Activation Plasmid (h)
sc-403964-ACT 20 µg

RNF4 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Nitric oxide synthase, endothelial (492-507)
CRB1000312-01 0.5 mg

Nitric oxide synthase, endothelial (492-507)

Sign In for Pricing
View Details