Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Todarodes pacificus Retinochrome

This Recombinant Todarodes pacificus Retinochrome spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Retinochrome, Retinal photoisomerase

UniProt

P23820

Expression Region

1-301

Origin

Todarodes pacificus (Japanese flying squid) (Ommastrephes pacificus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGNPAMTGLHQFTMWEHYFTGSIYLVLGCVVFSLCGMCIIFLARQSPKPRRKYAILIHV LITAMAVNGGDPAHASSSIVGRWLYGSVGCQLMGFWGFFGGMSHIWMLFAFAMERYMAVC HREFYQQMPSVYYSIIVGLMYTFGTFWATMPLLGWASYGLEVHGTSCTINYSVSDESYQS YVFFLAIFSFIFPMVSGWYAISKAWSGLSAIPDAEKEKDKDILSEEQLTALAGAFILISL ISWSGFGYVAIYSALTHGGAQLSHLRGHVPPIMSKTGCALFPLLIFLLTARSLPKSDTKK P

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1286408 1.0 µg DNA

MED16 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SARS-CoV-2 Omicron Spike RBD Protein
B2010590 100 µg

SARS-CoV-2 Omicron Spike RBD Protein

Sign In for Pricing
View Details
Vacuolar Protein sorting 53 homolog (S. cerevisiae)
339301 100 µL

Vacuolar Protein sorting 53 homolog (S. cerevisiae)

Sign In for Pricing
View Details
Anti-Influenza A Virus (A/Texas Strain, Nucleoprotein) Antibody
MBS4159344-01 0.1 mg

Anti-Influenza A Virus (A/Texas Strain, Nucleoprotein) Antibody

Sign In for Pricing
View Details
Anti-Influenza A Virus (A/Texas Strain, Nucleoprotein) Antibody
MBS4159344-02 5x 0.1 mg

Anti-Influenza A Virus (A/Texas Strain, Nucleoprotein) Antibody

Sign In for Pricing
View Details
MEOX1 (Mesenchyme Homeobox 1, MOX1) (HRP)
MBS6180559-01 0.1 mL

MEOX1 (Mesenchyme Homeobox 1, MOX1) (HRP)

Sign In for Pricing
View Details