Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Todarodes pacificus Retinochrome

This Recombinant Todarodes pacificus Retinochrome spans the amino acid sequence from region 1-301.

Product Specifications

Product Name Alternative

Retinochrome, Retinal photoisomerase

UniProt

P23820

Expression Region

1-301

Origin

Todarodes pacificus (Japanese flying squid) (Ommastrephes pacificus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGNPAMTGLHQFTMWEHYFTGSIYLVLGCVVFSLCGMCIIFLARQSPKPRRKYAILIHV LITAMAVNGGDPAHASSSIVGRWLYGSVGCQLMGFWGFFGGMSHIWMLFAFAMERYMAVC HREFYQQMPSVYYSIIVGLMYTFGTFWATMPLLGWASYGLEVHGTSCTINYSVSDESYQS YVFFLAIFSFIFPMVSGWYAISKAWSGLSAIPDAEKEKDKDILSEEQLTALAGAFILISL ISWSGFGYVAIYSALTHGGAQLSHLRGHVPPIMSKTGCALFPLLIFLLTARSLPKSDTKK P

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGAM1 Protein Vector (Rat) (pPM-C-His)
PV293581 500 ng

PGAM1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Tert-Butyl (2,5-dibromopyridin-4-yl) carbamate
OR1060413-01 100 mg

Tert-Butyl (2,5-dibromopyridin-4-yl) carbamate

Sign In for Pricing
View Details
Tert-Butyl (2,5-dibromopyridin-4-yl) carbamate
OR1060413-02 250 mg

Tert-Butyl (2,5-dibromopyridin-4-yl) carbamate

Sign In for Pricing
View Details
Tert-Butyl (2,5-dibromopyridin-4-yl) carbamate
OR1060413-03 1 g

Tert-Butyl (2,5-dibromopyridin-4-yl) carbamate

Sign In for Pricing
View Details
INMT Polyclonal Antibody
MBS9235921-01 0.1 mL

INMT Polyclonal Antibody

Sign In for Pricing
View Details
INMT Polyclonal Antibody
MBS9235921-02 5x 0.1 mL

INMT Polyclonal Antibody

Sign In for Pricing
View Details