Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alcelaphine herpesvirus 1 G-protein coupled receptor A5 (A5)

This Recombinant Alcelaphine herpesvirus 1 G-protein coupled receptor A5 (A5) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

G-protein coupled receptor A5

UniProt

O36364

Expression Region

1-302

Origin

Alcelaphine herpesvirus 1 (strain C500) (AIHV-1) (Malignant catarrhal fever virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADSSNSSLNCTAIHDQTVLILGQVFNSVWLFISVIFLYIFACKLCFRPRIYLWLSFYTL GFMLWVLCKVLQEYVTGKFKCVITNCIGDFCLVFLSCIMLGIMLDRYLKIQGTLRGGMKD IHIGIFVSASCFGSLMIALLDGLHMGDSEKLQFNGTESFKCLPATSVSSYKAQLMFKSIF CIICIIMCLILTCLTAKKVLGTRLRKKYVIVGNVGLLSFVNILLWVMIACGLLKQALESN LSLCPTKQSTYIYPYTMPVTVIFVLVIYLFSSTHMKNAMRKSGQIRHSLSSPNQVQSSFR LV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filter, Disk, N66, 0.22μm, SP,20x20cm, 5/Pk
1222858 5 Pieces/Case:1 Piece/ PACKS:5 PACKS/CASE

Filter, Disk, N66, 0.22μm, SP,20x20cm, 5/Pk

Sign In for Pricing
View Details
Human ZNF267 siRNA
abx940648-01 15 nmol

Human ZNF267 siRNA

Sign In for Pricing
View Details
Human ZNF267 siRNA
abx940648-02 30 nmol

Human ZNF267 siRNA

Sign In for Pricing
View Details
Tert-Butyl trans-octahydropyrrolo[3,4-b][1,4]oxazine-6-carboxylate
OR1001240-01 100 mg

Tert-Butyl trans-octahydropyrrolo[3,4-b][1,4]oxazine-6-carboxylate

Sign In for Pricing
View Details
Tert-Butyl trans-octahydropyrrolo[3,4-b][1,4]oxazine-6-carboxylate
OR1001240-02 250 mg

Tert-Butyl trans-octahydropyrrolo[3,4-b][1,4]oxazine-6-carboxylate

Sign In for Pricing
View Details
Tert-Butyl trans-octahydropyrrolo[3,4-b][1,4]oxazine-6-carboxylate
OR1001240-03 1 g

Tert-Butyl trans-octahydropyrrolo[3,4-b][1,4]oxazine-6-carboxylate

Sign In for Pricing
View Details