Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Alcelaphine herpesvirus 1 G-protein coupled receptor A5 (A5)

This Recombinant Alcelaphine herpesvirus 1 G-protein coupled receptor A5 (A5) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

G-protein coupled receptor A5

UniProt

O36364

Expression Region

1-302

Origin

Alcelaphine herpesvirus 1 (strain C500) (AIHV-1) (Malignant catarrhal fever virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADSSNSSLNCTAIHDQTVLILGQVFNSVWLFISVIFLYIFACKLCFRPRIYLWLSFYTL GFMLWVLCKVLQEYVTGKFKCVITNCIGDFCLVFLSCIMLGIMLDRYLKIQGTLRGGMKD IHIGIFVSASCFGSLMIALLDGLHMGDSEKLQFNGTESFKCLPATSVSSYKAQLMFKSIF CIICIIMCLILTCLTAKKVLGTRLRKKYVIVGNVGLLSFVNILLWVMIACGLLKQALESN LSLCPTKQSTYIYPYTMPVTVIFVLVIYLFSSTHMKNAMRKSGQIRHSLSSPNQVQSSFR LV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gorasp1 (NM_028976) Mouse Recombinant Protein
TP507123 20 µg

Gorasp1 (NM_028976) Mouse Recombinant Protein

Sign In for Pricing
View Details
Ethyl 2-furoate
T206005-01 50 mg

Ethyl 2-furoate

Sign In for Pricing
View Details
Ethyl 2-furoate
T206005-02 100 mg

Ethyl 2-furoate

Sign In for Pricing
View Details
KP6 killer toxin Antibody; HRP conjugated
MBS7003256-01 0.05 mg

KP6 killer toxin Antibody; HRP conjugated

Sign In for Pricing
View Details
KP6 killer toxin Antibody; HRP conjugated
MBS7003256-02 0.1 mg

KP6 killer toxin Antibody; HRP conjugated

Sign In for Pricing
View Details
KP6 killer toxin Antibody; HRP conjugated
MBS7003256-03 5x 0.1 mg

KP6 killer toxin Antibody; HRP conjugated

Sign In for Pricing
View Details