Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized protein C4C5.03 (SPAC4C5.03)

This Recombinant Schizosaccharomyces pombe Uncharacterized protein C4C5.03 (SPAC4C5.03) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Uncharacterized protein C4C5.03

UniProt

O14166

Expression Region

1-302

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFSTSSFIFDDDTPPKCPLATKASFIFSVYIIIGLIISYLLQIFRIVRLGSSQGLSFSY LILGYIGVLNAFSNVIALQISPLTECCQNYYSKKQCFANTTGLIQVGSQVLIMGCVLMAF WMFLPRPIHFVAADDENGLPIPEPLSVTKSRKWRKASYGLLGVFTWGLFIICLSATVLSS NFAWAAFLGFSASFCAVVQYVPQIIKTIRHQSHGALSIPMMMMQTPGGFLIGYLLSRLPG TNWTTYMMYIVSACLQGLLLMLCMFYLHKEKSRRKREELQATLQEEESQRAVRILEAETG PE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glass-Coated Multi-Well Plates
DP21US-9-GC10 10 Plates/Pack

Glass-Coated Multi-Well Plates

Sign In for Pricing
View Details
CD16 (FCGR3A) (NM_001127596) Human Over-expression Lysate
LY426817 100 µg

CD16 (FCGR3A) (NM_001127596) Human Over-expression Lysate

Sign In for Pricing
View Details
Hsp20 (HSPB6) Rabbit Polyclonal Antibody
TA377268 100 µL

Hsp20 (HSPB6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MIF Polyclonal Antibody
E-AB-40456-01 25 µL

MIF Polyclonal Antibody

Sign In for Pricing
View Details
MIF Polyclonal Antibody
E-AB-40456-02 100 µL

MIF Polyclonal Antibody

Sign In for Pricing
View Details
H4C7 Human Gene Knockout Kit (CRISPR)
KN415712 1 Kit

H4C7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details