Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Heme A synthase (ctaA)

This Recombinant Staphylococcus epidermidis Heme A synthase (ctaA) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q5HQ52

Expression Region

1-302

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFRKQNLKWLGVLATIIMTFVQLGGALVTKTGSEDGCGSSWPLCNGALLPENLPIQTIIE LSHRAVSAISLIVVLWLVITAWKNIGYIKEIKPLSIISVGFLLVQALVGAAAVIWQQNPY VLALHFGISLISFSSVFLMTLIIFSIDKKYEADILFIHKPLRILTWLMAIIVYLTIYTGA LVRHTKSSLAYGAWPIPFDDIVPHNAHDWVQFSHRGMALITFIWIMITFIHAIKNYSDNR TVRYGYTASFILVILQVITGALSVITNVNLIIALFHALFITYLFGMIAYFILLMLRTTRS QK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP90 alpha Rabbit Polyclonal Antibody (PE-Cy5)
orb972909 100 µL

HSP90 alpha Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Lentiviral mouse Rgs6 shRNA (UAS) - Lentiviral mouse Rgs6 shRNA (UAS, RFP) plasmid
GTR15229945 1 Vial

Lentiviral mouse Rgs6 shRNA (UAS) - Lentiviral mouse Rgs6 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Lentiviral mouse Steap1 shRNA (UAS) - Lentiviral mouse Steap1 shRNA (UAS) (25)
GTR15281141 1 Vial

Lentiviral mouse Steap1 shRNA (UAS) - Lentiviral mouse Steap1 shRNA (UAS) (25)

Sign In for Pricing
View Details
mmu-miR-8097 miRNA Antagomir
MNM03194 2x 5.0 nmol

mmu-miR-8097 miRNA Antagomir

Sign In for Pricing
View Details
Gyki 32887
orb1702217-01 25 mg

Gyki 32887

Sign In for Pricing
View Details
Gyki 32887
orb1702217-02 50 mg

Gyki 32887

Sign In for Pricing
View Details