Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Heme A synthase (ctaA)

This Recombinant Staphylococcus epidermidis Heme A synthase (ctaA) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q5HQ52

Expression Region

1-302

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFRKQNLKWLGVLATIIMTFVQLGGALVTKTGSEDGCGSSWPLCNGALLPENLPIQTIIE LSHRAVSAISLIVVLWLVITAWKNIGYIKEIKPLSIISVGFLLVQALVGAAAVIWQQNPY VLALHFGISLISFSSVFLMTLIIFSIDKKYEADILFIHKPLRILTWLMAIIVYLTIYTGA LVRHTKSSLAYGAWPIPFDDIVPHNAHDWVQFSHRGMALITFIWIMITFIHAIKNYSDNR TVRYGYTASFILVILQVITGALSVITNVNLIIALFHALFITYLFGMIAYFILLMLRTTRS QK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PSMD10 ELISA Kit
E031441 1 Each

Human PSMD10 ELISA Kit

Sign In for Pricing
View Details
KIF12 3'UTR GFP Stable Cell Line
TU061767 1.0 mL

KIF12 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
SEC14L3 (NM_174975) Human Recombinant Protein
PROTQ9UDX4 20 µg

SEC14L3 (NM_174975) Human Recombinant Protein

Sign In for Pricing
View Details
Human Apolipoprotein D ELISA Kit
MBS724117-01 48 Well

Human Apolipoprotein D ELISA Kit

Sign In for Pricing
View Details
Human Apolipoprotein D ELISA Kit
MBS724117-02 96 Well

Human Apolipoprotein D ELISA Kit

Sign In for Pricing
View Details
Human Apolipoprotein D ELISA Kit
MBS724117-03 5x 96 Well

Human Apolipoprotein D ELISA Kit

Sign In for Pricing
View Details