Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Heme A synthase (ctaA)

This Recombinant Staphylococcus epidermidis Heme A synthase (ctaA) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q5HQ52

Expression Region

1-302

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFRKQNLKWLGVLATIIMTFVQLGGALVTKTGSEDGCGSSWPLCNGALLPENLPIQTIIE LSHRAVSAISLIVVLWLVITAWKNIGYIKEIKPLSIISVGFLLVQALVGAAAVIWQQNPY VLALHFGISLISFSSVFLMTLIIFSIDKKYEADILFIHKPLRILTWLMAIIVYLTIYTGA LVRHTKSSLAYGAWPIPFDDIVPHNAHDWVQFSHRGMALITFIWIMITFIHAIKNYSDNR TVRYGYTASFILVILQVITGALSVITNVNLIIALFHALFITYLFGMIAYFILLMLRTTRS QK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CBX8 Antibody
CQA1864-01 30 µL

Anti-CBX8 Antibody

Sign In for Pricing
View Details
Anti-CBX8 Antibody
CQA1864-02 50 μL

Anti-CBX8 Antibody

Sign In for Pricing
View Details
Anti-CBX8 Antibody
CQA1864-03 100 µL

Anti-CBX8 Antibody

Sign In for Pricing
View Details
Anti-CBX8 Antibody
CQA1864-04 200 µL

Anti-CBX8 Antibody

Sign In for Pricing
View Details
PEnCMV-3xHA-CAMK2D (human) -3-SV40-Neo
BZ41980 1 Vial

PEnCMV-3xHA-CAMK2D (human) -3-SV40-Neo

Sign In for Pricing
View Details
Mmu-miR-20a-3p inhibitor
HY-RI02820-01 5 nmol

Mmu-miR-20a-3p inhibitor

Sign In for Pricing
View Details