Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Myeloid-associated differentiation marker-like protein 2 (myadml2)

This Recombinant Xenopus laevis Myeloid-associated differentiation marker-like protein 2 (myadml2) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Myeloid-associated differentiation marker-like protein 2

UniProt

Q5XGR0

Expression Region

1-302

Origin

Xenopus laevis (African clawed frog)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSSGGAYLNVDAIWSKVGFVRLLQMLFGCTTFSLVLHRAGFSAAYGTFCVFVWAFCFAL TILIVTCELTRLQSCLRSISWGNFTAAYAMLATLMTLTAAVIYPMYFTSLNCSSSDCSTK YFRLAVSVCAALLFVTYAVEVFLTRAKPGQPCSYMATASGLLKVVQAFVACVIFGALASE SQYKKFVATQWCVAVYSFCFGVTMVVVILNITGRALSLCCPFERFVVIYTVLAILMYISA AVIWPVYFFDSKYGSAKRPSRCTWGQCPWDSQLAVTIFTHINLILYIADLIYTQRLRIVA QR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-100 1x 100 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-100 1x 100 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF488A conjugate, 0.1mg/mL
BNC880851-100 1x 100 µL

HSP60 (LK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF568 conjugate, 0.1mg/mL
BNC681052-500 1x 500 µL

CD3e (B-B12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF640R conjugate, 0.1mg/mL
BNC401462-500 1x 500 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF405S conjugate, 0.1mg/mL
BNC042345-100 1x 100 µL

CD44v9 (Marker of Tumor Metastasis) (rCD44v9/1459), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details