Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 104 (Tas2r104)

This Recombinant Mouse Taste receptor type 2 member 104 (Tas2r104) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 104, T2R104, mT2R45

UniProt

Q7M723

Expression Region

1-302

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSALESILLSVATSEAMLGVLGNTFIVLVNYTDWVRNKKLSKINFILTGLAISRIFTIW IITLDAYTKVFLLTMLMPSSLHECMSYIWVIINHLSVWFSTSLGIFYFLKIANFSHYIFL WMKRRADKVFVFLIVFLIITWLASFPLAVKVIKDVKIYQSNTSWLIHLEKSELLINYVFA NMGPISLFIVAIIACFLLTISLWRHSRQMQSIGSGFRDLNTEAHMKAMKVLIAFIILFIL YFLGILIETLCLFLTNNKLLFIFGFTLSAMYPCCHSFILILTSRELKQATMRALQRLKCC ET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTDSS2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV665235 1.0 µg DNA

PTDSS2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
TRIM2, CT (TRIM2, KIAA0517, RNF86, Tripartite motif-containing protein 2, E3 ubiquitin-protein ligase TRIM2, RING finger protein 86) (Azide free) (HRP)
MBS6358180-01 0.2 mL

TRIM2, CT (TRIM2, KIAA0517, RNF86, Tripartite motif-containing protein 2, E3 ubiquitin-protein ligase TRIM2, RING finger protein 86) (Azide free) (HRP)

Sign In for Pricing
View Details
TRIM2, CT (TRIM2, KIAA0517, RNF86, Tripartite motif-containing protein 2, E3 ubiquitin-protein ligase TRIM2, RING finger protein 86) (Azide free) (HRP)
MBS6358180-02 5x 0.2 mL

TRIM2, CT (TRIM2, KIAA0517, RNF86, Tripartite motif-containing protein 2, E3 ubiquitin-protein ligase TRIM2, RING finger protein 86) (Azide free) (HRP)

Sign In for Pricing
View Details
Menin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-1988R-BF405-01 20 µL

Menin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Menin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-1988R-BF405-02 100 µL

Menin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Caspase 9 (CASP9) (NM_032996) Human Tagged ORF Clone
RC213375 10 µg

Caspase 9 (CASP9) (NM_032996) Human Tagged ORF Clone

Sign In for Pricing
View Details