Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 104 (Tas2r104)

This Recombinant Mouse Taste receptor type 2 member 104 (Tas2r104) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 104, T2R104, mT2R45

UniProt

Q7M723

Expression Region

1-302

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSALESILLSVATSEAMLGVLGNTFIVLVNYTDWVRNKKLSKINFILTGLAISRIFTIW IITLDAYTKVFLLTMLMPSSLHECMSYIWVIINHLSVWFSTSLGIFYFLKIANFSHYIFL WMKRRADKVFVFLIVFLIITWLASFPLAVKVIKDVKIYQSNTSWLIHLEKSELLINYVFA NMGPISLFIVAIIACFLLTISLWRHSRQMQSIGSGFRDLNTEAHMKAMKVLIAFIILFIL YFLGILIETLCLFLTNNKLLFIFGFTLSAMYPCCHSFILILTSRELKQATMRALQRLKCC ET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR89C (NM_001097616) Human 3' UTR Clone
SC208007 10 µg

GPR89C (NM_001097616) Human 3' UTR Clone

Sign In for Pricing
View Details
Biotin Rabbit anti-Mouse CD25 mAb
A27356-01 50 μg

Biotin Rabbit anti-Mouse CD25 mAb

Sign In for Pricing
View Details
Biotin Rabbit anti-Mouse CD25 mAb
A27356-02 500 μg

Biotin Rabbit anti-Mouse CD25 mAb

Sign In for Pricing
View Details
GRB10 Mouse Monoclonal Antibody [Clone ID: OTI6G1]
CF812351 100 µg

GRB10 Mouse Monoclonal Antibody [Clone ID: OTI6G1]

Sign In for Pricing
View Details
Phospho-alt-RPL36-S19 Rabbit pAb
MBS9145445-01 0.02 mL

Phospho-alt-RPL36-S19 Rabbit pAb

Sign In for Pricing
View Details
Phospho-alt-RPL36-S19 Rabbit pAb
MBS9145445-02 0.1 mL

Phospho-alt-RPL36-S19 Rabbit pAb

Sign In for Pricing
View Details