Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Heme A synthase (ctaA)

This Recombinant Staphylococcus epidermidis Heme A synthase (ctaA) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q8CPM2

Expression Region

1-302

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFRKQNLKWLGVLATIIMTFVQLGGALVTKTGSEDGCGSSWPLCNGALLPENLPIQTIIE LSHRAVSAISLIVVLWLVITAWKNIGYIKEIKPLSIISVGFLLVQALVGAAAVIWQQNPY VLALHFGISLISFSSVFLMTLIIFSIDKKYEADILFIHKPLRILTWLMAIIVYLTIYTGA LVRHTKSSLAYGAWPIPFDDIVPHNAHDWVQFSHRGMAFITFIWIMITFIHAIKNYSDNR TVRYGYTASFILVILQVITGALSVITNVNLIIALFHALFITYLFGMIAYFILLMLRTTRS LK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTNAP1 (Contactin Associated Protein 1, Caspr, CNTNAP, p190, NRXN4, Neurexin 4)
362619 200 µL

CNTNAP1 (Contactin Associated Protein 1, Caspr, CNTNAP, p190, NRXN4, Neurexin 4)

Sign In for Pricing
View Details
Recombinant Human CD300LB Protein, N-His
ARO-P17390-01 50 µg

Recombinant Human CD300LB Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD300LB Protein, N-His
ARO-P17390-02 100 µg

Recombinant Human CD300LB Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD300LB Protein, N-His
ARO-P17390-03 1 mg

Recombinant Human CD300LB Protein, N-His

Sign In for Pricing
View Details
Anti-STAT1 Antibody Picoband® (iFluor647 Conjugate)
PB9510-iFluor647 100 µg

Anti-STAT1 Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
alpha Tubulin Blocking Peptide
MBS9616641-01 1 mg

alpha Tubulin Blocking Peptide

Sign In for Pricing
View Details