Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Heme A synthase (ctaA)

This Recombinant Staphylococcus epidermidis Heme A synthase (ctaA) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

Q8CPM2

Expression Region

1-302

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFRKQNLKWLGVLATIIMTFVQLGGALVTKTGSEDGCGSSWPLCNGALLPENLPIQTIIE LSHRAVSAISLIVVLWLVITAWKNIGYIKEIKPLSIISVGFLLVQALVGAAAVIWQQNPY VLALHFGISLISFSSVFLMTLIIFSIDKKYEADILFIHKPLRILTWLMAIIVYLTIYTGA LVRHTKSSLAYGAWPIPFDDIVPHNAHDWVQFSHRGMAFITFIWIMITFIHAIKNYSDNR TVRYGYTASFILVILQVITGALSVITNVNLIIALFHALFITYLFGMIAYFILLMLRTTRS LK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Smoothelin-like protein 2, SMTNL2 ELISA Kit
MBS9329611-01 48 Well

Mouse Smoothelin-like protein 2, SMTNL2 ELISA Kit

Sign In for Pricing
View Details
Mouse Smoothelin-like protein 2, SMTNL2 ELISA Kit
MBS9329611-02 96 Well

Mouse Smoothelin-like protein 2, SMTNL2 ELISA Kit

Sign In for Pricing
View Details
Mouse Smoothelin-like protein 2, SMTNL2 ELISA Kit
MBS9329611-03 5x 96 Well

Mouse Smoothelin-like protein 2, SMTNL2 ELISA Kit

Sign In for Pricing
View Details
Mouse Smoothelin-like protein 2, SMTNL2 ELISA Kit
MBS9329611-04 10x 96 Well

Mouse Smoothelin-like protein 2, SMTNL2 ELISA Kit

Sign In for Pricing
View Details
Mouse Fibronectin Leucine Rich Transmembrane Protein 3 (FLRT3) ELISA Kit
YP-W23671-01 48 Tests

Mouse Fibronectin Leucine Rich Transmembrane Protein 3 (FLRT3) ELISA Kit

Sign In for Pricing
View Details
Mouse Fibronectin Leucine Rich Transmembrane Protein 3 (FLRT3) ELISA Kit
YP-W23671-02 96 Tests

Mouse Fibronectin Leucine Rich Transmembrane Protein 3 (FLRT3) ELISA Kit

Sign In for Pricing
View Details