Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4C3 (OR4C3)

This Recombinant Human Olfactory receptor 4C3 (OR4C3) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Olfactory receptor 4C3, Olfactory receptor OR11-98

UniProt

Q8NH37

Expression Region

1-302

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIPQNITEFFMLGLSQNSEVQRVLFVVFLLIYVVTVCGNMLIVVTITSSPTLASPVYFF LANLSFIDTFYSSSMAPKLIADSLYEGRTISYECCMAQLFGAHFLGGVEIILLTVMAYDR YVAICKPLHNTTIMTRHLCAMLVGVAWLGGFLHSLVQLLLVLWLPFCGPNVINHFACDLY PLLEVACTNTYVIGLLVVANSGLICLLNFLMLAASYIVILYSLRSHSADGRCKALSTCGA HFIVVALFFVPCIFTYVHPFSTLPIDKNMALFYGILTPMLNPLIYTLRNEEVKNAMRKLF TW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMACHC Mouse Monoclonal Antibody [Clone ID: OTI4E12]
TA504998 100 µL

MMACHC Mouse Monoclonal Antibody [Clone ID: OTI4E12]

Sign In for Pricing
View Details
DCDC2 Rabbit Polyclonal Antibody (APC)
orb1005356 100 µL

DCDC2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Nori® Equine Neuropeptide Y (NPY) ELISA Kit
GR106616 96 Well

Nori® Equine Neuropeptide Y (NPY) ELISA Kit

Sign In for Pricing
View Details
AVIL Peptide - middle region
MBS3229263-01 0.1 mg

AVIL Peptide - middle region

Sign In for Pricing
View Details
AVIL Peptide - middle region
MBS3229263-02 5x 0.1 mg

AVIL Peptide - middle region

Sign In for Pricing
View Details
LTB Polyclonal Antibody, HRP Conjugated
A55544-050 50 µL

LTB Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details