Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4C3 (OR4C3)

This Recombinant Human Olfactory receptor 4C3 (OR4C3) spans the amino acid sequence from region 1-302.

Product Specifications

Product Name Alternative

Olfactory receptor 4C3, Olfactory receptor OR11-98

UniProt

Q8NH37

Expression Region

1-302

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDIPQNITEFFMLGLSQNSEVQRVLFVVFLLIYVVTVCGNMLIVVTITSSPTLASPVYFF LANLSFIDTFYSSSMAPKLIADSLYEGRTISYECCMAQLFGAHFLGGVEIILLTVMAYDR YVAICKPLHNTTIMTRHLCAMLVGVAWLGGFLHSLVQLLLVLWLPFCGPNVINHFACDLY PLLEVACTNTYVIGLLVVANSGLICLLNFLMLAASYIVILYSLRSHSADGRCKALSTCGA HFIVVALFFVPCIFTYVHPFSTLPIDKNMALFYGILTPMLNPLIYTLRNEEVKNAMRKLF TW

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine alpha-L-fucosidase, AFU ELISA Kit
GTR10370510 96 Well

Bovine alpha-L-fucosidase, AFU ELISA Kit

Sign In for Pricing
View Details
Cytochrome P450 4A Antibody FITC Conjugated
C05518F 100 µL

Cytochrome P450 4A Antibody FITC Conjugated

Sign In for Pricing
View Details
Na+ CP type IXalpha Antibody
44365-01 50 µL

Na+ CP type IXalpha Antibody

Sign In for Pricing
View Details
Na+ CP type IXalpha Antibody
44365-02 100 µL

Na+ CP type IXalpha Antibody

Sign In for Pricing
View Details
CYP2A6 Antibody
orb677746 100 µL

CYP2A6 Antibody

Sign In for Pricing
View Details
GBX2 Rabbit Polyclonal Antibody
TA376509 100 µL

GBX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details