Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A2C0R7

Expression Region

1-303

Origin

Prochlorococcus marinus (strain NATL1A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHIFLELRSPGPDLFQLGPFSLRWYGLLIAISVLVGLNLSSELASKKGLKKSLINDLLP ILVLASVIGARIYYVAFEWRNYTGKNFWSSINFLNLNIPLPSALEIWGGGIAIHGALIMG TLSIIFFCRWRKEPFWDVIDVLVPSVALGQAIGRWGNFFNNEAFGIPTNLPWKLFIPYRF RPEIFSTQDYFHPTFLYESVWNIFVFGILIFLFRKSNKKELKLPPGSLSCLYLITYSLGR FWIEGLRTDPLCLGGVPPFCEGGLRIAQLISLFLISAGLLGIWRIYVSKKALPDPSSING RNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E3 SUMO protein ligase PIAS4 (PIAS4) Human qPCR Primer Pair (NM_015897)
HP211831 200 Reactions

E3 SUMO protein ligase PIAS4 (PIAS4) Human qPCR Primer Pair (NM_015897)

Sign In for Pricing
View Details
Goat anti-PRKACA Antibody
dAP-3329 50 µg

Goat anti-PRKACA Antibody

Sign In for Pricing
View Details
Caspase-6 discontinued
386841 200 µL

Caspase-6 discontinued

Sign In for Pricing
View Details
Rat Sox18 Pre-designed siRNA Set A
SI213544A 1 Each

Rat Sox18 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Fruit fly l (2) efl/CryAB Antibody Fluoro488 Conjugated
DZ33926-Fluoro488 200 µL/Vial

Anti-Fruit fly l (2) efl/CryAB Antibody Fluoro488 Conjugated

Sign In for Pricing
View Details
OPPA02512-1UG - FBL Protein
OPPA02512-1UG 1 µg

OPPA02512-1UG - FBL Protein

Sign In for Pricing
View Details