Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A2C0R7

Expression Region

1-303

Origin

Prochlorococcus marinus (strain NATL1A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHIFLELRSPGPDLFQLGPFSLRWYGLLIAISVLVGLNLSSELASKKGLKKSLINDLLP ILVLASVIGARIYYVAFEWRNYTGKNFWSSINFLNLNIPLPSALEIWGGGIAIHGALIMG TLSIIFFCRWRKEPFWDVIDVLVPSVALGQAIGRWGNFFNNEAFGIPTNLPWKLFIPYRF RPEIFSTQDYFHPTFLYESVWNIFVFGILIFLFRKSNKKELKLPPGSLSCLYLITYSLGR FWIEGLRTDPLCLGGVPPFCEGGLRIAQLISLFLISAGLLGIWRIYVSKKALPDPSSING RNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Igtp Protein Vector (Rat) (pPM-C-HA)
24787026 500 ng

Igtp Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
ALDH3B2 Human Over-expression Lysate
orb1362199 20 µg

ALDH3B2 Human Over-expression Lysate

Sign In for Pricing
View Details
FAM83D Antibody, Biotin conjugated
CSB-PA887979LD01HU-01 50 µg

FAM83D Antibody, Biotin conjugated

Sign In for Pricing
View Details
FAM83D Antibody, Biotin conjugated
CSB-PA887979LD01HU-02 100 µg

FAM83D Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal OBFC2B Antibody
NBP1-06561 100 µL

Rabbit Polyclonal OBFC2B Antibody

Sign In for Pricing
View Details
Olfr571 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4193104 1.0 µg DNA

Olfr571 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details