Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Heme A synthase (ctaA)

This Recombinant Staphylococcus aureus Heme A synthase (ctaA) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

A7X127

Expression Region

1-303

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGKKNLKWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIE LSHRAVSALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDY VLALHFGISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGA LVRHADASLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNR TVHYGYTAAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRS DKQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFDP2 Antibody
A44025-50UL 50 μL

TFDP2 Antibody

Sign In for Pricing
View Details
Mctp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3130108 1.0 µg DNA

Mctp1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Mycoplasma Pneumoniae MPN_449 Protein (aa.1-448)
VAng-Lsx04971-1mgEcoli 1 mg (E. coli)

Recombinant Mycoplasma Pneumoniae MPN_449 Protein (aa.1-448)

Sign In for Pricing
View Details
ANGL6 rabbit pAb
UB-GEN-11802 100 µL

ANGL6 rabbit pAb

Sign In for Pricing
View Details
Anti-SPON2 Antibody Picoband®, Carrier-free
A07465-1-carrier-free 100 µg/Vial

Anti-SPON2 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Cluster Of Differentiation 26 (Biotin)
545959 200 µL

Cluster Of Differentiation 26 (Biotin)

Sign In for Pricing
View Details