Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Heme A synthase (ctaA)

This Recombinant Staphylococcus aureus Heme A synthase (ctaA) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

A7X127

Expression Region

1-303

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGKKNLKWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIE LSHRAVSALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDY VLALHFGISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGA LVRHADASLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNR TVHYGYTAAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRS DKQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC644100 HDR Plasmid (h)
sc-417094-HDR 20 µg

LOC644100 HDR Plasmid (h)

Sign In for Pricing
View Details
LOC100192314 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6384407 1.0 µg DNA

LOC100192314 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Lentiviral mouse Fsbp shRNA (UAS) - Lentiviral mouse Fsbp shRNA (UAS, GFP) plasmid
GTR15223834 1 Vial

Lentiviral mouse Fsbp shRNA (UAS) - Lentiviral mouse Fsbp shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
IL32 (NM_004221) Human Recombinant Protein
TP761648 50 µg

IL32 (NM_004221) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Hordeum vulgare Photosystem II reaction center protein Z (psbZ)
MBS7027986-01 0.02 mg

Recombinant Hordeum vulgare Photosystem II reaction center protein Z (psbZ)

Sign In for Pricing
View Details
Recombinant Hordeum vulgare Photosystem II reaction center protein Z (psbZ)
MBS7027986-02 0.1 mg

Recombinant Hordeum vulgare Photosystem II reaction center protein Z (psbZ)

Sign In for Pricing
View Details