Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Heme A synthase (ctaA)

This Recombinant Staphylococcus aureus Heme A synthase (ctaA) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Heme A synthase, HAS, EC= 1.3.-.-, Cytochrome aa3-controlling protein

UniProt

A7X127

Expression Region

1-303

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGKKNLKWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIE LSHRAVSALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDY VLALHFGISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGA LVRHADASLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNR TVHYGYTAAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRS DKQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calibration Weight, 500g, OIML Class F2
GB-F2-500G-C 1 Each

Calibration Weight, 500g, OIML Class F2

Sign In for Pricing
View Details
lyophilised real-time PCR Master Mix for dual labeled probes
M-PCR-156L 960 Reactions x 20 μL

lyophilised real-time PCR Master Mix for dual labeled probes

Sign In for Pricing
View Details
MANEA Lentiviral Activation Particles (h)
sc-413213-LAC 200 µL

MANEA Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
RGD1359349 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7356105 3x 1.0 µg

RGD1359349 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Rabbit anti Gab1 (pTyr627)
pAP11291 100 µL

Rabbit anti Gab1 (pTyr627)

Sign In for Pricing
View Details
GIMAP3P 3'UTR GFP Stable Cell Line
TU058791 1.0 mL

GIMAP3P 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details