Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A9BE82

Expression Region

1-303

Origin

Prochlorococcus marinus (strain MIT 9211)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAYFATFRSPGPELLKVGFFTLRWYGLLIAFAVLIGLNLSNKLASIKGLSKNLINDLLP ILVISSIIGARAYYVIFEWRNYSGSNFWSSIQAFGLTISIPTFIKVWQGGIAIHGALLAG TIAILIFCRLKQEDFWDVLDVLIPSVALGQAIGRWGNFFNNEAFGLPTDLPWKLFIPYPY RPEFFLDNNYFHPTFLYESIWNILLFLCLISLIRLSIKGKLKLPSGSLSCVYAIIYSLGR VWIEGLRTDPLCLGGVPPFCIGGIRIAQLISTILFGLGLLGLFWIYQRKKKLPSLGIIGR KHQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EAF1 Polyclonal Conjugated Antibody
C30182 100 µL

EAF1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Rat Monoclonal anti-mouse Reg3D
mAP-0516 50 µg

Rat Monoclonal anti-mouse Reg3D

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein CrcB (crcB)
MBS7012639-01 0.02 mg

Recombinant Escherichia coli Protein CrcB (crcB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein CrcB (crcB)
MBS7012639-02 0.1 mg

Recombinant Escherichia coli Protein CrcB (crcB)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein CrcB (crcB)
MBS7012639-03 5x 0.1 mg

Recombinant Escherichia coli Protein CrcB (crcB)

Sign In for Pricing
View Details
Cyclin B1 Antibody (CCNB1)
F52191-0.08ML 0.08 mL

Cyclin B1 Antibody (CCNB1)

Sign In for Pricing
View Details