Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Protoheme IX farnesyltransferase (ctaB)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Protoheme IX farnesyltransferase (ctaB) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Protoheme IX farnesyltransferase, EC= 2.5.1.-, Heme B farnesyltransferase, Heme O synthase

UniProt

Q49WP1

Expression Region

1-303

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKEQTLAHNSSRVTFKELQQIIKMGLVQGNLIPAFAGSWLAIVLANHSFLSSIPQILMM LVGSTLIMGGACALNNYYDQDIDSIMPSKQQRPTVNERISNRNLLILSFGMMLIGEALLF ALNIPSGVIGLLGIVGYVSFYSIWSKRHTVWNTVIGSFPGAVPPLIGWTAIEGNISLVAV ALFLVIFCWQPIHFYALAIKRKDEYSLANIPMLPSVKGFNRTRVSMFFWLVVLLPLPFLL SSLGVTFIVLATLLNLGWLYLGLTSFKKDTDQTKWATKMFIYSLNYLVVFFVLVVVISLI QMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPRC6A Rabbit Polyclonal Antibody
TA372672 100 µL

GPRC6A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-Quinuclidinol-d7
TRC-Q795782-25MG 25 mg

3-Quinuclidinol-d7

Sign In for Pricing
View Details
NHP2 Rabbit Polyclonal Antibody
TA366118 100 µL

NHP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dylight 649 Conjugated Ulex europaeus Lectin (Gorse, Furze) -UEA-I-
DY649-2201-1 1 mg

Dylight 649 Conjugated Ulex europaeus Lectin (Gorse, Furze) -UEA-I-

Sign In for Pricing
View Details
Cytokeratin 1 (Suprabasal Keratinocyte Marker) (KRT1/1840), Biotin conjugate, 0.1mg/mL
BNCB1840-500 1x 500 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (KRT1/1840), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Forkhead Box Protein P3 (FOXP3) ELISA Kit
RDR-FOXP3-Hu-01 96 Tests

Human Forkhead Box Protein P3 (FOXP3) ELISA Kit

Sign In for Pricing
View Details