Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Protoheme IX farnesyltransferase (ctaB)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Protoheme IX farnesyltransferase (ctaB) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Protoheme IX farnesyltransferase, EC= 2.5.1.-, Heme B farnesyltransferase, Heme O synthase

UniProt

Q49WP1

Expression Region

1-303

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKEQTLAHNSSRVTFKELQQIIKMGLVQGNLIPAFAGSWLAIVLANHSFLSSIPQILMM LVGSTLIMGGACALNNYYDQDIDSIMPSKQQRPTVNERISNRNLLILSFGMMLIGEALLF ALNIPSGVIGLLGIVGYVSFYSIWSKRHTVWNTVIGSFPGAVPPLIGWTAIEGNISLVAV ALFLVIFCWQPIHFYALAIKRKDEYSLANIPMLPSVKGFNRTRVSMFFWLVVLLPLPFLL SSLGVTFIVLATLLNLGWLYLGLTSFKKDTDQTKWATKMFIYSLNYLVVFFVLVVVISLI QMF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF729 Human Gene Knockout Kit (CRISPR)
KN435244 1 Kit

ZNF729 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human UBR2 activation kit by CRISPRa
GA108203 1 Kit

Human UBR2 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse H2bw2 activation kit by CRISPRa
GA208166 1 Kit

Mouse H2bw2 activation kit by CRISPRa

Sign In for Pricing
View Details
Glutaminase Recombinant Rabbit Monoclonal Antibody [SN68-09]
ET1611-5 100 µL

Glutaminase Recombinant Rabbit Monoclonal Antibody [SN68-09]

Sign In for Pricing
View Details
(-)-2'-Deoxy-3'-oxa-4'-thiocytidine (Apricitabine)
TRC-D245513-50MG 50 mg

(-)-2'-Deoxy-3'-oxa-4'-thiocytidine (Apricitabine)

Sign In for Pricing
View Details
Fluo-8L™, AM
21097-AAT 10x 50 µg

Fluo-8L™, AM

Sign In for Pricing
View Details