Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

Q58257

Expression Region

1-303

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDATLIALGALALSGALATVAGCAEDLESDVGSQSNPNSQVQLAPQMGNIHRYFNKAISG EPVSYGLYVAVAGTVAYAIMQMGLNPILALILGAGVAAFVHGAYAISAYLGRIVGQSKNF GQPVYWDVVMSHLGPIVGHGFIAVFCMVLMAYLANTILGNPFPLPLIALIFGITVGAIGS STGDVHYGAEREYQKYPFGGGVPVANHGDIDIKAEYGLRNGMDSSYFCSRLGGVLTGLCF GLIVFLDGWRGVLGDILKGGQGGSVITASIISIVIGLIIVAILAIINRKVEVFARNKYGP YTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CITED2 (NM_001168388) Human Recombinant Protein
TP329801L 1 mg

CITED2 (NM_001168388) Human Recombinant Protein

Sign In for Pricing
View Details
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF647 conjugate, 0.1mg/mL
BNC472224-500 1x 500 µL

S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Psma1 Rabbit Polyclonal Antibody
TA363251 100 µL

Psma1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD109 Mouse Monoclonal Antibody [Clone ID: B-E47]
AM31244AF-N 200 µg

CD109 Mouse Monoclonal Antibody [Clone ID: B-E47]

Sign In for Pricing
View Details
IFIT3 (NM_001031683) Human Over-expression Lysate
LC421898 20 µg

IFIT3 (NM_001031683) Human Over-expression Lysate

Sign In for Pricing
View Details
NUDT5 Antibody
KC-45779-01 50 μL

NUDT5 Antibody

Sign In for Pricing
View Details