Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Methanocaldococcus jannaschii Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

Q58257

Expression Region

1-303

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDATLIALGALALSGALATVAGCAEDLESDVGSQSNPNSQVQLAPQMGNIHRYFNKAISG EPVSYGLYVAVAGTVAYAIMQMGLNPILALILGAGVAAFVHGAYAISAYLGRIVGQSKNF GQPVYWDVVMSHLGPIVGHGFIAVFCMVLMAYLANTILGNPFPLPLIALIFGITVGAIGS STGDVHYGAEREYQKYPFGGGVPVANHGDIDIKAEYGLRNGMDSSYFCSRLGGVLTGLCF GLIVFLDGWRGVLGDILKGGQGGSVITASIISIVIGLIIVAILAIINRKVEVFARNKYGP YTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS504959 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Synphilin 1 (SNCAIP) Human Gene Knockout Kit (CRISPR)
KN422425 1 Kit

Synphilin 1 (SNCAIP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG1), 0.2mg/mL
BNUB1686-500 1x 500 µL

VEGF (Vascular Endothelial Growth Factor) (VG1), 0.2mg/mL

Sign In for Pricing
View Details
FITC Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017UC-01 25 µg

FITC Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details
FITC Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017UC-02 100 µg

FITC Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details
Sterol carrier protein 2 (SCP2) (NM_002979) Human Over-expression Lysate
LY401042 100 µg

Sterol carrier protein 2 (SCP2) (NM_002979) Human Over-expression Lysate

Sign In for Pricing
View Details