Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken PQ-loop repeat-containing protein 2 (PQLC2)

This Recombinant Chicken PQ-loop repeat-containing protein 2 (PQLC2) spans the amino acid sequence from region 1-303.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 2

UniProt

Q5ZJX0

Expression Region

1-303

Origin

Gallus gallus (Chicken)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEGLRAPPPPGNGSECPDGARWVLRLLGECARDGRDVGSALLGLLSIGCFAAAALPQFY QACKTGIMDRALSIYFLLGWLGGDLLNLIGSFLANQLPLQVYTAVYYVLADLVMLSLYGY YKAKNWGTGATASINAACLFCLLGTATTLTVLSHDTGPAPNPAAFGGRSLLSLGLEGPGP EPISKTEIIGFAIGSISSVLYLCSRLPQIYTNYRRKSTAGVSFLLFALVMLGNLLYGTSV LLKNPEPGQSEGDYILHHLPWLIGSLGVLSLDVIISFQFLAYRTGQPSAGEEREALLAEH GDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP4Z2P Polyclonal Antibody, APC-Cy7 Conjugated
bs-14164R-APC-Cy7 100 µL

CYP4Z2P Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
CD29 (pY795) Antibody
MBS8583755-01 0.1 mL

CD29 (pY795) Antibody

Sign In for Pricing
View Details
CD29 (pY795) Antibody
MBS8583755-02 0.1 mL (AF635)

CD29 (pY795) Antibody

Sign In for Pricing
View Details
CD29 (pY795) Antibody
MBS8583755-03 0.1 mL (AF610)

CD29 (pY795) Antibody

Sign In for Pricing
View Details
CD29 (pY795) Antibody
MBS8583755-04 0.1 mL (AF405S)

CD29 (pY795) Antibody

Sign In for Pricing
View Details
CD29 (pY795) Antibody
MBS8583755-05 0.1 mL (AF405L)

CD29 (pY795) Antibody

Sign In for Pricing
View Details